PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA13264
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family BBR-BPC
Protein Properties Length: 306aa    MW: 34075.4 Da    PI: 9.5407
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA13264genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind59.41.7e-18161711141
                  GAGA_bind   1 mdddgsre..rnkg.yye...............paaslkenlglqlmssiaerdaki..rernlalsekkaavaerdmaflqrd 64 
                                mddd ++e  r+k  +y+               ++++l   +++++ s++aer+a++   e ++a+sek++a+a+rd a+ qrd
  Tp57577_TGAC_v2_mRNA13264  16 MDDDHQYEngRHKVeFYRgahspwntdpqhqikEQNALV--MNKKIRSIMAERQAALleLELEAAISEKNEALAARDAALRQRD 97 
                                88888887799999899899****999765553224455..999************977677889******************* PP

                  GAGA_bind  65 kalaernkalverdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaa 141
                                +ala+r++al+erdn+l+al+ ++ +  s+ p++ ++ +g+k ++++ + + ++++++a+ + +  + +a p+++ +
  Tp57577_TGAC_v2_mRNA13264  98 EALAQRDNALLERDNALAALQSRSGA--SNFPFNGGIQRGSKRMHHSSN-HISNISEPAYSTADIIIRDASPVTSPT 171
                                *********************97665..88999************8887.6699******99999988888887655 PP

2GAGA_bind2501.5e-76169305163301
                  GAGA_bind 163 kakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPv 246
                                  +k kk +e+ ++k  +e+  ++ k+e++ +d++ln +++De+ +PvPvCsCtG++rqCYkWGnGGWqS+CCttt+S++PLP+
  Tp57577_TGAC_v2_mRNA13264 169 SPTKIKKLGEDLNRKAYSEG--TKIKSEWDRQDVGLNLIAFDETVMPVPVCSCTGVPRQCYKWGNGGWQSSCCTTTLSMHPLPQ 250
                                45678888888888888887..67************************************************************ PP

                  GAGA_bind 247 stkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                                 +++r+aRi+grKmS+++f +lL++ a++G+dls p+DLkd+WA+HGtn+++ti+
  Tp57577_TGAC_v2_mRNA13264 251 LPNKRHARIGGRKMSGSVFIRLLSRFASQGHDLSIPLDLKDYWARHGTNRYITIK 305
                                ******************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062174.2E-8816305IPR010409GAGA-binding transcriptional activator
SMARTSM012261.8E-12816305IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
LNPTTASVAK SSESKMDDDH QYENGRHKVE FYRGAHSPWN TDPQHQIKEQ NALVMNKKIR  60
SIMAERQAAL LELELEAAIS EKNEALAARD AALRQRDEAL AQRDNALLER DNALAALQSR  120
SGASNFPFNG GIQRGSKRMH HSSNHISNIS EPAYSTADII IRDASPVTSP TKIKKLGEDL  180
NRKAYSEGTK IKSEWDRQDV GLNLIAFDET VMPVPVCSCT GVPRQCYKWG NGGWQSSCCT  240
TTLSMHPLPQ LPNKRHARIG GRKMSGSVFI RLLSRFASQG HDLSIPLDLK DYWARHGTNR  300
YITIK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003630555.20.0GAGA-binding transcriptional activator BBR/BPC6-like protein
SwissprotQ8S8C61e-123BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLG7LI340.0G7LI34_MEDTR; GAGA-binding transcriptional activator BBR/BPC6-like protein
STRINGGLYMA08G01240.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69743348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-104basic pentacysteine 4